PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009103644.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 961aa    MW: 106705 Da    PI: 6.6734
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009103644.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.81.1e-28639689252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek+i le+l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  XP_009103644.1 639 EKTIGLEVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 689
                     799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.041628709IPR003035RWP-RK domain
PfamPF020421.1E-24642689IPR003035RWP-RK domain
SuperFamilySSF542772.55E-23853945No hitNo description
SMARTSM006665.0E-27858943IPR000270PB1 domain
PROSITE profilePS5174528.375858943IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.2E-22858942No hitNo description
PfamPF005647.7E-18860942IPR000270PB1 domain
CDDcd064071.99E-39860942No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 961 aa     Download sequence    Send to blast
MEGSGGGGFL PNPSFGAFPE TAMDMDFMEE LFFDGCWLET TDGKSLKQTT GQQAPSSTNM  60
NDNNNNNNSF LYGYQFSENP SQDHISNGDT GRKFPPGFLK MEDLTNQPMT QVPFDQSAAT  120
SSSQAEKFLL EETERGRRYW IAPRTSQGPS SSVKDRLFQA INGLKVQDKD FLIQIWLPIQ  180
QEGKNFLTTL DQPHFFNPKY KSLKRYRDVS VSYNFLADED SKESVGLPGR VFLGKLPEWT  240
PDVRFFRSEE YPRIKEAQRC DVRGSLALPV FESGSGICLG VVEIVTTTQK MNYRPELENI  300
CKALEAVNLR SSANMKSPSS EFLQVYKQFY CAVIPEVSVF LTSVCRSYDL PLALTWAPCA  360
RQGRGGSRHS DENFSECVST LDSACFVLDQ QSHNFQEACS EHHLLQGEGI VGKAFKATKL  420
FFVPEVTTFS KTNYPLAHHA KISGLHAALA VPLKNKFNGS VEFVLEFFFP KNCLDTEAQQ  480
EMLKSLSVTL QNDFRSLNLV IDKEMELEVV FPVREELLFS GNAETGESLK PLPLEEISHE  540
DSSWISHMIN ANEKGKGVSL SWEYQKEEPK EEFMLTSGWD NNNNQIGSFL SDAEQFQKAS  600
NSGGLRLDID PSFDSASFGV GQTLLGSRRP GEKRRTKTEK TIGLEVLRQY FAGSLKDAAK  660
SIGVCPTTLK RICRQHGITR WPSRKIKKVG HSLKKLQLVI DSVQGVQGSI QLDSFYTSFP  720
ELSSPNNVSS TGTGTSFKNN DQPSHLNPQT ENGVSPAVAP TSSPPSSSCS HSSGSSTCCS  780
TGANQSTNTA NTSNTISTRM AENAGAILKR ARSEVRLRTV NQEETKSLSR TLSHRAFSEH  840
PLLSNLPRSK SLKAVGGASK VKATFGEAKV RFTFLPTWGF RELQHEIARR FNIDNNIIAT  900
FDLKYLDDDK EWVLLTCEAD LEECIDIYRS SHSRTIKISV HEASQAKLGG SFGSTGPVPL  960
L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1896560.0AC189656.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS015K01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009103808.10.0PREDICTED: protein NLP2
RefseqXP_009103768.10.0PREDICTED: protein NLP2
RefseqXP_009103715.10.0PREDICTED: protein NLP2
RefseqXP_009103644.10.0PREDICTED: protein NLP2
RefseqXP_009103570.10.0PREDICTED: protein NLP2
SwissprotQ7X9B90.0NLP2_ARATH; Protein NLP2
TrEMBLM4D5430.0M4D543_BRARP; Uncharacterized protein
STRINGBra011600.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein